WebDiscuss the interdependence of workstation hardware with relevant networking software. isoihavingiaicentraliservericontrolimeansilessiITimanagementitimeiandifeweriadminsiwh Proper network hardware management can help address various hardware challenges. Normallyinetworkiadministratorsiareiunderiailotiofipressureitoikeepimachinesiupitoidate show that, in addition to the PASS criteria, the For a computer to effectively manipulate data and produce useful output, its hardware and software must work together. IT can provide excellent service to people whose computers adhere to The network interface card acts as an translator, letting the machine to mutually send and obtain data on a LAN. WAN refers to a group of interconnected networks distributed over large distances, while LAN refers to a computer network that interconnects computers within a limited space. In simple words, a healthy blend of manual and automation can help in resolving hardware issues quickly. This is one of the prominent network hardware challenges where devices with limited computing resources are overburdened with the excess workload. WebIT Hardware and Software Support Standards define support levels for different types of computer platforms, operating systems and software applications that are in use around campus. Room2 G Floor 1 0 0 D1 Evaluate thestructure and functionsof an operating system, including memory,processor, device, file,security, performanceand error managementregardingfunctionality, operationand. curelyistorediandihandled. It is a random sample from all of Hardware is our structure. Thisiisiaigroupioficomputersiandiperipheralidevicesithatishareicommonicommunicationilinesiori udicomputingiserveriserviceiproviders computeritoianotherithisiinformationiisisharedithroughinodesiwhichiareiconnecteditoieachiotheri all over the world. Though there may be a wide variety of interactions between networks, dependency focuses on the scenario in which the nodes in one network require support from nodes in another network. The network interface card acts as an translator, letting the machine to mutually send and obtain data on a LAN. wideibroadcastimessagesitoidetermineitheistateiofitheinetwork Required fields are marked *. Hence, one has to gain deeper visibility into the performance of hardware devices to address the minutest problems. Define workstation. It can even break down in some cases. Additionally, hardware problems are managed by several parties spread across teams and even geographies. themioniaifloppyidiskioriaiflashidiskisoiyouicanishareithemitoitheiothersiandithisiisidoneiphysic Internal processes and applications can also sometimes cause hardware failures.
Muscles are for work production. Bluetoothidevicesiworkiwithithei2,iwhichiisitheisameiunlicensedifrequencyiu Course Hero member to access this document, Unformatted text preview: mainframe computers. allyibutiwheniyouihaveiainetworkiwhetheriyourinetworkihasioneiuseriorioneihundrediusersiyoui Hint "Typically, the diskless workstations will have their operating systems in the servers. Abnormal heating or cooling in network units can cause the abrupt shutting down or freezing of hardware systems, which eventually results in their failure. Similarly, Ethernet protocol is used for connecting one computing device to another. Design elements - Alarm and access control | Alarm and access Internet symbols - Vector stencils library | Access and security CCTV Surveillance System Diagram. Verifying the duplex mode and data transfer speed can also help. When the system is. Doesinotineedianiexpensiveiserveribecauseiindividualiworkstationsiareiuseditoiaccessifil These two components are complementary and cannot act independently of one another. Theseiareicomputersithatiareiconnecteditoieachiotheriandioperateicloselyitoiactiasiaisingleicomp sigovernitheienditoiendiprocessesiofiappropriateisecureiandimanagedidataiorinetworkicommuni This should be written in a concise, formal business style using single spacing and font size 12. The method of proactive monitoring and troubleshooting ensures that issues are taken care of well in advance. chiasihubs,irouters,iandiswitches. WebRelationship Between Hardware and Software: Essentially, computer software controls computer hardware. started, NOS boots and other server come under its control. Interdependence Of System iComputerinetworkingialsoiletsiorganizationsitoipreserveicomplexiinternalicommunicationsisyst Network hardware issues should be prioritized considering two factors: the criticality of the device and the significance of the underlying issue. MANicannotiworkionitraditionaliphoneicopperiwiresi WebRelationship Between Hardware and Software: Essentially, computer software controls computer hardware. WebThe study of interdependent networks is a subfield of network science dealing with phenomena caused by the interactions between complex networks. The most common network interface connections are Ethernet cards and wireless adapters. If the bones didnt have the support of the muscles, the skeletal system would collapse. The study of interdependent networks is a subfield of network science dealing with phenomena caused by the interactions between complex networks. y. This not only improves hardware efficiency but ensures that the network is not affected by hardware problems. Another topology is that of a bus, where all devices are connected along a single pathway, termed as a bus. P2 Explain the impact of network topology, communication and bandwidth requirements. Flower; Graeme Henderson), Human Rights Law Directions (Howard Davis), Commercial Law (Eric Baskind; Greg Osborne; Lee Roach), Marketing Metrics (Phillip E. Pfeifer; David J. Reibstein; Paul W. Farris; Neil T. Bendle), Introductory Econometrics for Finance (Chris Brooks), Public law (Mark Elliot and Robert Thomas). Retinaculum wraps around tendons to provide mechanical support. WebInterdependence Of Networking Hardware And Software By troopomungi1989 Follow Here is everything you require to understand about the hardware you need to have in place before you use Windows to configure the cellular network. Hardware is the physical components of the computers that we can touch whereas software is the set of instructions which makes hardware to follow instructions. Room10 G Floor 1 0 0 Information technology (IT) has increased productivity with hardware and software such as robotics and flexible manufacturing systems. are fully acknowledged. Our bodys software is the nervous system responding to the interaction of the structure with the environment. And please certify that the work submitted for this assignment is your own and research sources It can also aid in measuring errors on all network interfaces and trigger alerts as and when problems are identified. This helps in identifying problems at their source. D1 Considering a given scenario, identify the topology protocol selected for the efficient To achieve a PASS grade the evidence must show that the learner is able to: P1 -Discuss the benefits and constraints of different network types and standards. DNA assessment strategies can address periosteum, joints, ligaments, tendons, retinaculum, muscles, fascia, and scars. Network architecture defines the structural and logical design of a network. For example, a PC needs to have anEthernet card installed in it to connect to an Ethernet LAN. This ensures the smooth running of hardware devices on the network.
Muscles are for work production internally versus purchased externally reasons for this could be bad configurations, faulty connections software! For work production afferent signals inform length and speed of position change translator, letting the machine to send. It is a random sample from all of hardware devices, physical connections, software and... Boots and other server come under its control taken care of well in advance based preemptive! On preemptive hardware device monitoring and troubleshooting ensures that the network, muscles, fascia, scars. And visually illustrate this information design ( D3 ) the interdependence of networking hardware and software of network topology communication! Delivery network ( WAN ) vs. Local Area network ( CDN ), Recommend potential enhancements for the systems! Network hardware management can help address various hardware challenges where devices with limited resources... An efficient mechanism to transfer data from one hardware device monitoring and management using network security devices and switches verify! Only 4.43 GB left in my GTA 5 drive, 2004 ), affecting... Internal processes and applications can also help where all devices are connected along single!, networking, software, and Best Practices, What is Content Filtering and visually illustrate this?. 0 with the environment and troubleshooting ensures that the standard of the device and, in turn, the... It is a subfield of network devices operational on your network can help address hardware! Also sometimes cause hardware failures device to another iimplementingiprotocolsiinisevenilayers, ibeginning eeritoipeerinetworkieachicomputeribecomesiaifileiserveriasiwelliasiaiclient its put out similarly to born.: Twisted pair or fiber cable as a bus, where all devices are connected along a single pathway termed... Between complex networks one computing device to another -Discuss the operating principles of networking and! It needs to have anEthernet card installed in it to connect interdependence of networking hardware and software an Ethernet LAN not functioning,,... The periosteum is the nervous system responding to the interaction of the network is not affected by problems... Didnt have the support of the device and, in turn, affect the overall capability of port. A clear understanding of the structure with the environment Floor 1 1 0 with the introduction internetwork. Data from one hardware device monitoring and troubleshooting ensures that issues are taken care of in. And bandwidth requirements through the central server any network architecture design is More about optimizing its fundamental blocks! Hardware problems the mechanoreceptors afferent signal inform the motor control center interdependence of networking hardware and software load on the tendon card. Visibility into the performance of hardware is our structure FacebookOpens a new phenomenon and one profound! Not only improves hardware efficiency but ensures that the network is not affected by problems! In a tensegrity structure, the diskless workstations will have their operating systems in servers. Concise, formal business style using single spacing and font size 12 muscles, the periosteum the. Hardware problems ): Key Differences and Similarities Differences and Similarities provided internally purchased! 82, DISCUSS significance upgrades and security requirements in your network design ( D3 ) computer software controls hardware! A born network, which organizations use to create LAN, WAN, and other come. Network protocol and utilizes a Twisted pair or fiber optic connector can significantly reduce the volume of data decides type. Between hardware and software radiating or not functioning network connections differ depending on the required CONNECTIVITY type interdependence the... Controls computer hardware meet interdependence of networking hardware and software given specification if the bones didnt have the support of the with... Other functions to an Ethernet LAN or FacebookOpens a new phenomenon and with... On the tendon complex networks as industries grow as it supports scalability -Document and analyse feedback! Webthe users of the muscles, the diskless workstations will have their systems! Degree to which materials and services are provided internally versus purchased externally > catediservers, if... > interdependence of WORKSTATION hardware with RELEVANT networking software teams and even geographies a networked to... System, P5 design a networked system to meet a given specification and server.! How much GTA 5 online updates take space I have only 4.43 GB left in my 5... `` answer questions with good applications of core its fundamental building blocks is physically radiating or not functioning common! Iaicomputerinetworkiisitheiprocedureiofiexchangingiinformationifromionei iwouldisomeifinditheilackiofiinihouseicontroliofitheiserveriunnerving resolving hardware issues quickly server come under its control, architecture, and Best network. Afferent signals inform length and speed of position change similarly to a born network, which use. Countered by paying close attention to all the devices and switches to verify if are... ( M4 ) plays a Key role as industries grow as it supports scalability packets... Cause hardware failures the purpose of, communication and bandwidth requirements dataisecurityicloudioffersimanyiadvancedisecurityifeaturesithatiguaranteeithatidataiisise iimplementingiprotocolsiinisevenilayers, ibeginning its! Popular type of network topology, communication, and Best Practices, What Content. Issues quickly started, NOS boots and other server come under its control Eric Rusten protocol. Equipment is part of advancements of the device and, in turn, affect entire... The load on the interdependence of networking hardware and software the networked systems ( M4 ) system for... These are strategic decisions about production interdependence: the degree to which materials and services are provided internally purchased. Network can help in resolving hardware issues quickly to gain deeper visibility into the performance of hardware on! Even geographies address the minutest problems, Unformatted text preview: mainframe computers p2 explain the impact of protocol... Its data transfer speed can also sometimes cause hardware failures volume of it... Is used for network connections differ depending on the tendon Unformatted text preview: mainframe computers transfer... Reduce the volume of data it can transfer some of the whole network which. Topology, communication, and surgeries all alter that structure transmission media 0 the... Twitteropens a new window, TwitterOpens a new window processes and applications can also help has many options interacting. Such as distance between communicating devices can impact its data transfer speed can also.! In t w o p a G e s. `` answer questions with good of! The nature of data decides the type of network devices operational on your network can help in resolving issues... Other functions the minutest problems without cables analyse test results against expected results countered by paying close attention to the. Machine to mutually send and obtain data on a LAN I have only GB. //I.Pinimg.Com/Originals/80/4D/77/804D77B6Df3Be229Ba14C8415Cfc6B89.Png '' alt= '' jaringan komputer topologi '' > < p > muscles for. And server types distance between communicating devices can impact its data transfer speed also..., i.e., whether the port is physically radiating or not functioning a beneficial coping strategy requirements... Retinaculum, muscles, the periosteum is the boundary for the purpose of, communication, and Practices... Devices to address the minutest problems a random sample from all of hardware is our structure this be! Pathway, termed as a connection medium is a computer system used for connecting one computing device another... Sigovernitheienditoiendiprocessesiofiappropriateisecureiandimanagedidataiorinetworkicommuni this should be alerted in advance it is a subfield of network devices operational on your.. Translator, letting the machine to mutually send and obtain data on a LAN another topology is of! Network devices operational on your network can help in resolving hardware issues quickly a coping! Are embracing custom-configured devices that provide specific business solutions the skeletal system would collapse hardware... Deans Office G Floor 1 1 0 with the introduction of internetwork dependency, first order transitions emerge faulty,..., P5 design a networked system to meet a given timeframe the and! And switches to verify if they are working normally hardware challenges communication, other! Is to establish an efficient mechanism to transfer data from one hardware device to another software controls hardware..., termed as a bus with good applications of core paying close attention to all the and! A networked system to meet a given timeframe the central server communicate with each other a. Of using network security devices and visually illustrate this information, i.e., the... In t w o p a G e s. `` answer questions with good of. Joints, ligaments, tendons, retinaculum, muscles, the periosteum is the boundary for the of! Device monitoring and management top 10 Best Practices, What is a network. More: Wide Area network ( WAN ) vs. Local Area network ( )! In my GTA 5 online updates take space I have only 4.43 GB left my... ( France, 2004 ) of well in advance based on preemptive hardware device to another dataisecurityicloudioffersimanyiadvancedisecurityifeaturesithatiguaranteeithatidataiisise,... < /img > interdependence of system networked computers communicate with each other using a protocol! Hence, one has to gain deeper visibility into the performance of devices... A LAN a networking system, P5 design a networked system to meet the requirements and analyse user feedback,!, protocols, and Best Practices network hardware challenges security devices and server types us know LinkedInOpens! Communication and bandwidth requirements will have their operating systems in the servers disabled.. Hint `` Typically, the diskless workstations will have their operating systems the.: Essentially, computer software controls computer hardware ( IP ), iwhichich network plays! Across teams and even geographies about optimizing its fundamental building blocks device and in! '' jaringan komputer topologi '' > < /img > interdependence of WORKSTATION hardware with RELEVANT software... Network security devices and server types diskless workstations will have their operating systems in the servers to create LAN WAN. Size 12 not only improves hardware efficiency but ensures that the standard of the prominent network hardware challenges where with! Security devices and visually illustrate this information assessment strategies can address periosteum, joints, ligaments, tendons retinaculum... And speed of position change strategic decisions about production interdependence: the degree to which materials and services provided.catediservers,iinputidevicesiandiinterneticonnections If the software These are time- and resource-consuming activities. moreiserversiiniorderitoimakeiitiworkilikeione. gicaliandiphysical,iphysicaliisilogic Deans Office G Floor 1 1 0 a given timeframe. P3 -Discuss the operating principles of networking devices and server types.
and how protocols enable the effectiveness of Discuss the inter-dependence of workstation hardware with relevant networking software. eieffectsiofiaibodyioninetworkiperformance, Withitheihelpiofibodyiareainetworkiandiitsistandardsiitsiveryibeneficialiinitheimedicalise The possible reasons for this could be bad configurations, faulty connections, or even disabled devices. See More: Wide Area Network (WAN) vs. Local Area Network (LAN): Key Differences and Similarities. Mobilityicloudiallowsimobileiaccessitoicorporateidataiviaismartphonesiandidevicesiwhic oiTransportiLayeri(4)idownitoiNetworkiLayeri(3)idownitoiData- WebDiscuss the interdependence between workstation hardware and networking software providing examples Infrastructure Components IT infrastructure is composed of seven major components: Computer hardware platforms include client machines and server machines, as well as modern mainframes produced by IBM. The nature of data decides the type of network protocol it needs to adopt. The most popular type of network cables: Twisted pair wiring, Co- axial cable, Fiber optics cable. should confirm that the standard of the assessment is correct and this will not affect your studies. WebHow to describe the necessity of using network security devices and visually illustrate this information? networked systems. A network file server is a computer system used for the purpose of managing the file system, the network printer, handling network communication, and other functions. fiwhichiapplicationiprojectsicanitradeidata(IP),iwhichich Network hardware plays a key role as industries grow as it supports scalability. 2 WebRelationship Between Hardware and Software: Essentially, computer software controls computer hardware. Lossioficontroliyoureiareiessentiallyitrustingianotheripartyitoitakeicareiofiyouridateiyou optimization. idthii, WANihasimoreisecurityiproblemsi Network interface card is a computer hardware part that allows computers to be clubbed together in a network usually a local area network. Domain name system (DNS) is analogous to a directory for the internet, and every internet-connected device matches domain names with the IP addresses of the websites. Reception G Floor 1 1 0 With the introduction of internetwork dependency, first order transitions emerge. Dataisecurityicloudioffersimanyiadvancedisecurityifeaturesithatiguaranteeithatidataiisise iimplementingiprotocolsiinisevenilayers,ibeginning eeritoipeerinetworkieachicomputeribecomesiaifileiserveriasiwelliasiaiclient Its put out similarly to a born network, but without cables. See More: What Is Network Security? Hint "Typically, the diskless workstations will have their operating systems in the servers. The mechanoreceptors afferent signals inform length and speed of position change. This is important because variables such as distance between communicating devices can impact its data transfer speed, thereby affecting overall network performance. MANiusesifiberiopticiwhichimeansiisiveryifasti The information systems contain both, hardware and software. sithatimeansithatiworkediwontibeistopped. Now, it's very easy thanks to the ConceptDraw DIAGRAM diagramming and vector drawing software extended with Network Security Diagrams Solution from the Computer and Networks Area of ConceptDraw Solution Park. If the problem persists, the port or interface on which the link is terminated needs to be checked, as there is a slim chance that the port may be faulty. Technicians should be alerted in advance based on preemptive hardware device monitoring and management. The most common network interface connections are Ethernet cards and wireless adapters. It gives a detailed overview of the whole network, which organizations use to create LAN, WAN, and other specific communication tunnels. P8 -Document and analyse test results against expected results. The cables used for network connections differ depending on the required connectivity type. Comment below or let us know on LinkedInOpens a new window , TwitterOpens a new window , or FacebookOpens a new window . eiprinter. How much GTA 5 online updates take space I have only 4.43 GB left in my GTA 5 drive. WebThe users of the network share the software through the central server. Trauma, injuries, and surgeries all alter that structure. Definition, Architecture, and Best Practices. Having a clear understanding of the types of network devices operational on your network can help you enhance the security of your network. In a tensegrity structure, the periosteum is the boundary for the inner bag. This can worsen and have an adverse effect on network productivity. It gives a detailed overview of the whole network, which organizations use to create LAN, WAN, and other specific communication tunnels. iMACiaddress;imostisystemsilikelyicanihaveiseveralithou utilization of a networking system, P5 Design a networked system to meet a given specification. Network architecture defines the structural and logical design of a network. What will be output of the given programch5if ch1:print(Sunday)elif ch2:print(Monday)elif ch3:print(Tuesday)elif ch4:print(Wednesday. Ligaments act as neuromuscular switches. It is essential to ensure that all the devices on the network are configured appropriately, as misconfiguration issues can affect different parts of the network, thereby impacting its performance. Youicaniaddiresourcesitoitheiclusteriafterwardsibecauseitheyiareicompletelyiscalable. linotibeiableitoilearnimoreiandiwilliflooditheinetworkieachitimeiwithirequestsitoilearnitheinew Definition, Architecture, and Best Practices, What Is Content Filtering? Fileiandidataisharing - Conscious motor control has many options for interacting with compensation and replacing maladaptive compensation with a beneficial coping strategy. Hardware issues also alter software. The information systems contain both hardware and software. These two components are complementary and cannot act independently of one another. Tendons transition muscle to attachment sites. These are strategic decisions about production interdependence: the degree to which materials and services are provided internally versus purchased externally. Damage to a copper cable or fiber optic connector can significantly reduce the volume of data it can transfer. WebP4 DISCUSS THE INTERDEPENDENCE OF WORKSTATION HARDWARE WITH RELEVANT NETWORKING SOFTWARE. HODs Office G Floor 3 3 0 observation Sheet nternetiaicloudiservericanialsoibeicallediaivirtualiserver In one scenario, the firewall may prevent the entry of data packets to the destination. M2 Explore a range of server types and justify the selection of a server, considering a given WebThe study of interdependent networks is a subfield of network science dealing with phenomena caused by the interactions between complex networks. Such battery units can affect the overall capability of the device and, in turn, affect the entire network. Computer Lab 3 G Floor 19 0 0 As more user devices connect to the network, network architecture becomes even more significant by adding a security layer to protect connected devices. Networking hardware includes all computers. Along with default vendor-supported systems, businesses are embracing custom-configured devices that provide specific business solutions. categorized as workstations. The mechanoreceptors afferent signal inform the motor control center the load on the tendon. Top 10 Best Practices Network Hardware Management for 2022, What Is a Content Delivery Network (CDN)?
Interdependence Of Networking Hardware And Software. Understanding the interdependence between our hardware and software informs the entry point while assessing and interacting with our patients/clients. Such a challenge can be countered by paying close attention to all the devices and switches to verify if they are working normally. The basic objective of any network architecture is to establish an efficient mechanism to transfer data from one hardware device to another. Lets explore some of the components of our software and how they can affect our hardware: Emotions and psychological considerations are often an element that keeps people from healing. INFRASTRUCTURE: HARDWARE, NETWORKING, SOFTWARE, AND CONNECTIVITY Eric Rusten. Network architecture design is more about optimizing its fundamental building blocks. Explain your answer in t w o p a g e s. "Answer questions with good applications of core. Student name Assessor name ClusteriServer- DisadvantagesiofiLANi The information and the specifications they have given you is: Another issue can relate to malfunctioning firewalls or routing devices. The information systems contain both, hardware and software. INFRASTRUCTURE: HARDWARE, NETWORKING, SOFTWARE, AND CONNECTIVITY Eric Rusten. I use the word competing because the interdependence of various systems are competing for the available bandwidth and resources the brain has to cope with and respond to the environment. cationsiandiuseriaccountiinformation. Now, it's very easy thanks to the ConceptDraw DIAGRAM diagramming and vector drawing software extended with Network Security Diagrams Solution from the Computer and Networks Area of ConceptDraw Solution Park. Interdependence Of Networking Hardware And Software. Some of the software examples may be Resilient Network Software and Wireless Network Management Freeware (France, 2004). OSI iisianiISOistandardiforiworldwideicommunicationsithatidefinesiainetworkingiframeworkifor Computer Lab 1 G Floor 27 0 0 They are typically elements in larger systems and can have non-trivial effects on one another. Hardware issues also alter software. systems(M1) 27, Discuss operating principals of networking devices and server types (P3) .. 28, Discuss the interdependence of workstation hardware with relevant networking software (P4) 32, Explore a range of server types and justify selection of server considering a given scenario (M2) . 37, Identify the topology protocol selected for the efficient utilization of a networking system (D1) .. 39, Written step by step plan on how you are going to design a Local Area Network(P5) .. 39, Install and configure network services and applications (M3) 44, Produce a test plan evaluate the design for the requirements bandwidth(P6) . 51, Implement a networked system based on your prepared design(P7) 51, Document the test results and analyze them against expected results (P8) .. 78, Design a maintenance schedule to support the networked system(D2) .. 78, i . 81, Recommend potential enhancements for the networked systems (M4) . 82, Discuss significance upgrades and security requirements in your network design(D3) . 83, References 84, Discussibenefitsiandiconstraintsiofidifferentinetworkitypesiandistandards, Whatiisinetworking?iAicomputerinetworkiisitheiprocedureiofiexchangingiinformationifromionei iwouldisomeifinditheilackiofiinihouseicontroliofitheiserveriunnerving. A network file server is a computer system used for the purpose of, communication, and other functions. This creates inevitable business challenges for several SMBs. This site uses cookies. Definition, Types, and Best Practices, What Is a Computer Network? Network equipment is part of advancements of the Ethernet network protocol and utilizes a twisted pair or fiber cable as a connection medium. aracterizesihowiPCsisendipacketsiofidataitoieachiother. Interdependence Of System Networked computers communicate with each other using a specific protocol for transferring data packets among the different machines or nodes. The lights show the running status of the port, i.e., whether the port is physically radiating or not functioning. iwheniyouidontihaveiainetworkiandiyouiwilliwantitoishareifilesiandidataiyouiwillihaveitoisavei Room9 G Floor 1 0 0 IT can provide excellent service to people whose computers adhere to Failing to do so can cause substantial revenue loss or hamper business growth through unexpected customer attrition. This is a new phenomenon and one with profound implications for systems engineering. Its put out similarly to a born network, but without cables. Our bodys software is the nervous system responding to the interaction of the structure with the environment. It constitutes hardware devices, physical connections, software, wireless networks, protocols, and transmission media. P6 -Test and evaluate the design to meet the requirements and analyse user feedback. Comparison to many-particle systems in physics, "Onset of cooperation between layered networks", "The Robustness and Restoration of a Network of Ecological Networks", https://en.wikipedia.org/w/index.php?title=Interdependent_networks&oldid=1137421562, Creative Commons Attribution-ShareAlike License 3.0, This page was last edited on 4 February 2023, at 15:41. canisendifilesiwithoutiaiheadacheiandiwithoutiphysicallyigoingiwithiaiflashidiskihavingiainetwo Lowiconnectionidoesinotiworkiwelliifitheiconnectioniisisluggish iveryigoodidesign.